PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca31341.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 456aa    MW: 51240.5 Da    PI: 4.5165
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca31341.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM43.59.6e-142774250
         NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
                ppG++F+Ptdeel+++yL +k++g +l++ + +++v+iy+++P++L +k
  Dca31341.1 27 PPGYKFDPTDEELITKYLLPKIDGAPLPI-NLMHDVNIYNHNPEQLAEK 74
                9****************************.89**************743 PP

2NAM71.12.8e-2212418863128
         NAM  63 krdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  rdkky +g+r+nr++ +gyWkatg dk++ s kg +vg +k Lvfykg+ p+g kt W+mhe+r 
  Dca31341.1 124 DRDKKYLNGQRPNRKAGEGYWKATGADKDINS-KGVKVGYRKALVFYKGNPPHGLKTLWIMHEFRS 188
                 689*****************************.999****************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-152475IPR003441NAC domain
PROSITE profilePS5100539.29326223IPR003441NAC domain
PfamPF023652.9E-1827187IPR003441NAC domain
SuperFamilySSF1019411.06E-26123223IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MDHNNISNDV GQTTSIAQIE NYLDSFPPGY KFDPTDEELI TKYLLPKIDG APLPINLMHD  60
VNIYNHNPEQ LAEKFTWAVP TLPPVFQGIG KQLCGRLRTF LSFMPSKKLC LSLFHGNSSL  120
DMVDRDKKYL NGQRPNRKAG EGYWKATGAD KDINSKGVKV GYRKALVFYK GNPPHGLKTL  180
WIMHEFRSSQ PSVVKKPHPS SIHSNQDISM RLDDFVLCRI YKKNEAQPRK NSSPTGQQEV  240
EENNGDEAEA EGEGEPEDKV SPPVNDDDNN IFVVDNNWNN NVFDTNANIY DSTNNNNIVV  300
DNNNLVNKVY NPSNDNNITS LDDINMYRAN NGHNTNINTT GNVYNAMNNT GVDYPYLQPW  360
PLINIYSTDE TGTNSSFTNM NNDQLPPCGN YFFPDDINDN DFCHRLLFGE LNRTIEDPID  420
LPGPRQPTIV AAADDTNDDT DVDTKPVSPP PPPPTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-382522616168NO APICAL MERISTEM PROTEIN
1ut4_B1e-382522616168NO APICAL MERISTEM PROTEIN
1ut7_A1e-382522616168NO APICAL MERISTEM PROTEIN
1ut7_B1e-382522616168NO APICAL MERISTEM PROTEIN
3swm_A2e-382522619171NAC domain-containing protein 19
3swm_B2e-382522619171NAC domain-containing protein 19
3swm_C2e-382522619171NAC domain-containing protein 19
3swm_D2e-382522619171NAC domain-containing protein 19
3swp_A2e-382522619171NAC domain-containing protein 19
3swp_B2e-382522619171NAC domain-containing protein 19
3swp_C2e-382522619171NAC domain-containing protein 19
3swp_D2e-382522619171NAC domain-containing protein 19
4dul_A1e-382522616168NAC domain-containing protein 19
4dul_B1e-382522616168NAC domain-containing protein 19
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.35e-44NAC family protein